Facts about Red Dead Redemption

1. 13

   A single playthrough of Red Dead Redemption 2's main story requires approximately 60 to 100 hours to complete, depending on mission completion rate and player exploration habits.

   Red Dead RedemptionJun 6sharegameplaymeasurementduration
2. 12

   Sadie Adler's character model required 20 separate facial animations just to express grief after her husband's death in Red Dead Redemption 2's opening sequence.

   Red Dead RedemptionMay 21shareanimationcharacterdesignstorytelling
3. 11

   John Marston, the protagonist of the original Red Dead Redemption, appears as a minor character in Red Dead Redemption 2's epilogue set in 1911.

   Red Dead RedemptionMay 21sharenarrativecharactersequel
4. 10

   Red Dead Redemption 2's map spans approximately 75 square miles, making it one of the largest open worlds in gaming history with interconnected regions designed for seamless exploration.

   Red Dead RedemptionMay 21sharemeasurementworldbuildingdesign
5. 09

   Approximately 1,200 non-player characters populate the towns and settlements of Red Dead Redemption 2, each with daily routines and dialogue that create a living world.

   Red Dead RedemptionMay 21shareaidesignsimulation
6. 08

   Across Red Dead Redemption 2's map, players can discover 43 legendary animal species with unique pelts that grant exclusive crafting materials unavailable through standard hunting.

   Red Dead RedemptionMay 21sharehuntingcollectiblesgameplay
7. 07

   During development, Rockstar Games motion-captured over 2,000 horses to authentically recreate equine animations for Red Dead Redemption 2's riding mechanics.

   Red Dead RedemptionMay 21shareanimationmotion-capturedevelopment
8. 06

   Players can hunt and skin 200 different animal species across Red Dead Redemption 2's map, with each pelt type affecting crafting materials and merchant prices differently.

   Red Dead RedemptionMay 21sharegameplaywildlifemechanics
9. 05

   Over 500,000 individual animations were created for Red Dead Redemption 2, allowing for fluid character movements across countless interactions and environmental scenarios.

   Red Dead RedemptionMay 21shareanimationvideogameproduction
10. 04

    The Van der Linde gang's camp in Red Dead Redemption 2 features over 200 unique animations and interactions that change based on player choices and story progression.

    Red Dead RedemptionMay 21shareanimationgameplaydesign
11. 03

    Arthur Morgan's voice actor Roger Clark recorded approximately 110,000 lines of dialogue for Red Dead Redemption 2's protagonist character.

    Red Dead RedemptionMay 21sharevoiceactingproductiongaming
12. 02

    In Red Dead Redemption 2, players can find 90 cigarette cards hidden throughout the game world, collectible items that unlock rewards when complete sets are gathered.

    Red Dead RedemptionMay 21sharecollectiblesgamingcompletionist
13. 01

    Rockstar Games released Red Dead Redemption 2 on October 26, 2018, becoming one of the most expensive video games ever produced with a budget exceeding $300 million.

    Red Dead RedemptionMay 21sharevideogamesmeasurement2018